Recombinant Full Length Human CCS Protein, GST-tagged

• Cat.No.: CCS-3038HF
• Product Overview: Human CCS full-length ORF (NP_005116.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 274 amino acids
• Description: Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008]
• Molecular Mass: 55.4 kDa
• AA Sequence: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCS copper chaperone for superoxide dismutase [ Homo sapiens ]
• Official Symbol: CCS
• Synonyms: CCS; copper chaperone for superoxide dismutase; superoxide dismutase copper chaperone; MGC138260
• Gene ID: 9973
• mRNA Refseq: NM_005125
• Protein Refseq: NP_005116
• MIM: 603864
• UniProt ID: O14618