Recombinant Full Length Arabidopsis Thaliana Abc Transporter B Family Member 26, Chloroplastic(Abcb26) Protein, His-Tagged
Cat.No. : | RFL15025AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter B family member 26, chloroplastic(ABCB26) Protein (Q8RY46) (60-700aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (60-700) |
Form : | Lyophilized powder |
AA Sequence : | CSTVNGAVAETAEYYEGEGDNVSLAEKIRQCIDFLRTILPGGSWWSFSDEVDGRFIAKPV TVWRALSRMWELVAEDRWVIFAAFSTLIVAALSEITIPHFLTASIFSAQSGDIAVFHRNV KLLVTLCVTSGICSGIRGCFFGIANMILVKRMRETLYSTLLFQDISFFDSQTVGDLTSRL GSDCQQVSRVIGNDLNMIFRNVLQGTGALIYLLILSWPLGLCTLVICCILAAVMFVYGMY QKKTAKLIQEITASANEVAQETYSLMRTVRVYGTEKQEFKRYNHWLQRLADISLRQSAAY GIWNWSFNTLYHATQIIAVLVGGLSILAGQITAEQLTKFLLYSEWLIYATWWVGDNLSSL MQSVGASEKVFQMMDLKPSDQFISKGTRLQRLTGHIEFVDVSFSYPSRDEVAVVQNVNIS VHPGEVVAIVGLSGSGKSTLVNLLLQLYEPTSGQILLDGVPLKELDVKWLRQRIGYVGQE PKLFRTDISSNIKYGCDRNISQEDIISAAKQAYAHDFITALPNGYNTIVDDDLLSGGQKQ RIAIARAILRDPRILILDEATSALDAESEHNVKGVLRSIGNDSATKRSVIVIAHRLSTIQ AADRIVAMDSGRVVEMGSHKELLSKDGLYARLTKRQNDAVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCB26 |
Synonyms | ABCB26; TAP1; At1g70610; F24J13.18; F5A18.21; ABC transporter B family member 26, chloroplastic; ABC transporter ABCB.26; AtABCB26; Antigen peptide transporter-like 1; Transporter associated with antigen processing-like protein 1; AtTAP1 |
UniProt ID | Q8RY46 |
◆ Recombinant Proteins | ||
CHTF8-698R | Recombinant Rhesus Macaque CHTF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23459DF | Recombinant Full Length Drosophila Melanogaster Kynurenine 3-Monooxygenase(Cn) Protein, His-Tagged | +Inquiry |
FECH-1138H | Recombinant Human FECH | +Inquiry |
HSD17B8-1109H | Recombinant Human HSD17B8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Acsl3-9319M | Recombinant Mouse Acsl3, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
PTI-1900B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPDR1-1038HCL | Recombinant Human EPDR1 cell lysate | +Inquiry |
RFTN1-539HCL | Recombinant Human RFTN1 lysate | +Inquiry |
SK-MEL-28-064WCY | Human Skin Melanoma SK-MEL-28 Whole Cell Lysate | +Inquiry |
SLC12A4-1806HCL | Recombinant Human SLC12A4 293 Cell Lysate | +Inquiry |
C9orf152-7941HCL | Recombinant Human C9orf152 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCB26 Products
Required fields are marked with *
My Review for All ABCB26 Products
Required fields are marked with *
0
Inquiry Basket