Recombinant Full Length Arabidopsis Thaliana 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase 2(Lpat2) Protein, His-Tagged
Cat.No. : | RFL20606AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 1-acyl-sn-glycerol-3-phosphate acyltransferase 2(LPAT2) Protein (Q8LG50) (1-389aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-389) |
Form : | Lyophilized powder |
AA Sequence : | MVIAAAVIVPLGLLFFISGLAVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIV DWWAGVKIQVFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKS SKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKL KAAQEYAASSELPIPRNVLIPRTKGFVSAVSNMRSFVPAIYDMTVTIPKTSPPPTMLRLF KGQPSVVHVHIKCHSMKDLPESDDAIAQWCRDQFVAKDALLDKHIAADTFPGQQEQNIGR PIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGITISALGLGIITLCMQILIRSSQSER STPAKVVPAKPKDNHHPESSSQTETEKEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LPAT2 |
Synonyms | LPAT2; LPAAT2; At3g57650; F15B8.160; 1-acyl-sn-glycerol-3-phosphate acyltransferase 2; Lysophosphatidyl acyltransferase 2 |
UniProt ID | Q8LG50 |
◆ Native Proteins | ||
ATF-177D | Native Dog Apotransferrin | +Inquiry |
Lectin-1734U | Active Native Ulex Europaeus Agglutinin I Protein, Rhodamine labeled | +Inquiry |
Hemoglobin F-034H | Native Human Hemoglobin F Protein | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
RPE-135 | Native Red algae R-Phycoerythrin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC16A1-1802HCL | Recombinant Human SLC16A1 293 Cell Lysate | +Inquiry |
Prostate-728P | Pig Prostate Lysate, Total Protein | +Inquiry |
CHMP5-7530HCL | Recombinant Human CHMP5 293 Cell Lysate | +Inquiry |
SYTL2-1299HCL | Recombinant Human SYTL2 293 Cell Lysate | +Inquiry |
CEBPG-7596HCL | Recombinant Human CEBPG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LPAT2 Products
Required fields are marked with *
My Review for All LPAT2 Products
Required fields are marked with *
0
Inquiry Basket