Recombinant Full Length Esx-2 Secretion System Protein Ecce2(Ecce2) Protein, His-Tagged
Cat.No. : | RFL31395HF |
Product Overview : | Recombinant Full Length ESX-2 secretion system protein EccE2(eccE2) Protein (O05459) (1-537aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-537) |
Form : | Lyophilized powder |
AA Sequence : | MTSKLTGFSPRSARRVAGVWTVFVLASAGWALGGQLGAVMAVVVGVALVFVQWWGQPAWS WAVLGLRGRRPVKWNDPITLANNRSGGGVRVQDGVAVVAVQLLGRAHRATTVTGSVTVES DNVIDVVELAPLLRHPLDLELDSISVVTFGSRTGTVGDYPRVYDAEIGTPPYAGRRETWL IMRLPVIGNTQALRWRTSVGAAAISVAQRVASSLRCQGLRAKLATATDLAELDRRLGSDA VAGSAQRWKAIRGEAGWMTTYAYPAEAISSRVLSQAWTLRADEVIQNVTVYPDATCTATI TVRTPTPAPTPPSVILRRLNGEQAAAAAANMCGPRPHLRGQRRCPLPAQLVTEIGPSGVL IGKLSNGDRLMIPVTDAGELSRVFVAADDTIAKRIVIRVVGAGERVCVHTRDQERWASVR MPQLSIVGTPRPAPRTTVGVVEYVRRRKNGDDGKSEGSGVDVAISPTPRPASVITIARPG TSLSESDRHGFEVTIEQIDRATVKVGAAGQNWLVEMEMFRAENRYVSLEPVTMSIGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ESX-2 secretion system protein EccE2(eccE2) |
UniProt ID | O05459 |
◆ Recombinant Proteins | ||
Slc25a20-1767R | Recombinant Rat Slc25a20 protein, His & T7-tagged | +Inquiry |
P2RY12-1497H | Recombinant Human P2RY12, GST-tagged | +Inquiry |
MOB1A-3381R | Recombinant Rat MOB1A Protein, His (Fc)-Avi-tagged | +Inquiry |
HEXA-178H | Recombinant Human HEXA Protein, His-tagged | +Inquiry |
ADAMTS12-3006M | Recombinant Mouse ADAMTS12, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA2-29D | Native Dog Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
Lectin-1836R | Native Ricinus Communis Ricin B Chain Protein | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCNN1D-2027HCL | Recombinant Human SCNN1D 293 Cell Lysate | +Inquiry |
NDUFB5-3904HCL | Recombinant Human NDUFB5 293 Cell Lysate | +Inquiry |
DNAJC18-496HCL | Recombinant Human DNAJC18 cell lysate | +Inquiry |
TAF11-1277HCL | Recombinant Human TAF11 293 Cell Lysate | +Inquiry |
PSTPIP1-2732HCL | Recombinant Human PSTPIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESX-2 secretion system protein EccE2(eccE2) Products
Required fields are marked with *
My Review for All ESX-2 secretion system protein EccE2(eccE2) Products
Required fields are marked with *
0
Inquiry Basket