Recombinant Full Length Anabaena Variabilis Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL32261AF |
Product Overview : | Recombinant Full Length Anabaena variabilis Cytochrome c biogenesis protein CcsB(ccsB) Protein (Q3M6F7) (1-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anabaena variabilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-461) |
Form : | Lyophilized powder |
AA Sequence : | MTTDNSAPTASPWWSLPGKFLRREFLPVLTDLRLAIALLLIIALFSISGTVIEQGQSPAF YQANYPEHPALFGFLTWKVIQVVGLDHVYRTWWFLSLLVLFGTSLTACTFTRQLPALKTA QRWKYYEEPRQFQKLALSAELDAGSVNSLSQILQNRRYKIFQEKDDILYARKGIVGRIGP IIVHIGIVTILLGSIWGAMTGFIAQEMVPSGETFQVKNIIDAGPLAAGQFPQDWSVRVNR FWIDYTPKGGIDQFYSDMSVLDNQGKEVDHKKIFVNQPLRYHGVTFYQTDWGISGVRVRL NKSPIFQLPMALLNTNGQGRIWGTWIPTKPDLSEGVSLLAKDLQGMVLIYDAQGKLVDTV RAGMSTQVNGVTLKVLDVVGSTGLQIKADPGIPIVYTGFGILMLGVVMSYFSHSQIWALQ KGDRLYVGGKTNRAQVAFEQEVLEILERLSSQSATASNQQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; Ava_3824; Cytochrome c biogenesis protein CcsB |
UniProt ID | Q3M6F7 |
◆ Native Proteins | ||
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
HBA2-27784TH | Native Human HBA2 | +Inquiry |
TF-391H | Native Human Transferrin | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TERF2-1146HCL | Recombinant Human TERF2 293 Cell Lysate | +Inquiry |
Fetal Liver-147H | Human Fetal Liver Lysate | +Inquiry |
CALHM1-7892HCL | Recombinant Human CALHM1 293 Cell Lysate | +Inquiry |
TMEM100-1018HCL | Recombinant Human TMEM100 293 Cell Lysate | +Inquiry |
DYDC2-518HCL | Recombinant Human DYDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket