Recombinant Full Length Arabidopsis Thaliana Probable Cyclic Nucleotide-Gated Ion Channel 12(Cngc12) Protein, His-Tagged
Cat.No. : | RFL35378AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable cyclic nucleotide-gated ion channel 12(CNGC12) Protein (Q8GWD2) (1-649aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-649) |
Form : | Lyophilized powder |
AA Sequence : | MNHRRSKFARIDSMGVDGKLKSVRGRLKKVYGKMKTLENWRKTVLLACVVALAIDPLFLF IPLIDSQRFCFTFDKTLVAVVCVIRTFIDTFYVIHIIYYLITETIAPRSQASLRGEIVVH SKATLKTRLLFHFIVDIISVLPIPQVVVLTLIPLSASLVSERILKWIILSQYVPRIIRMY PLYKEVTRAFGTVAESKWAGAALNLFLYMLHSYVFGAFWYLSSIERKSKCWRAACARTSD CNLTVTDLLCKRAGSDNIRFLNTSCPLIDPAQITNSTDFDFGMYIDALKSGVLEVKPKDF PRKFVYCFWWGLRNISALGQNLETSNSAGEIFFAIIICVSGLLLFAVLIGNVQKYLQSST TRVDEMEEKRRDTEKWMSYRVIPEYLKERIRRFEDYKWRETKGTEEEALLRSLPKDLRLE TKRYLYLDMLKRVPWLNIMDDGWLLEAVCDRVKSVFYLANSFIVREGHPVEEMLIVTRGK LKSTTGSHEMGVRNNCCDLQDGDICGELLFNGSRLPTSTRTVMTLTEVEGFILLPDDIKF IASHLNVFQRQKLQRTFRLYSQQWRSWAAFFIQAAWRKHCKRKLSKTRDNENIPQGTQLN LASTLYVSRFVSKALQNRRKDTADCSSSPDMSPPVPHKPADLEFAKAEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNGC12 |
Synonyms | CNGC12; At2g46450; F11C10.14; Probable cyclic nucleotide-gated ion channel 12; Cyclic nucleotide- and calmodulin-regulated ion channel 12 |
UniProt ID | Q8GWD2 |
◆ Recombinant Proteins | ||
BCRC-0367B | Recombinant Bacillus subtilis BCRC protein, His-tagged | +Inquiry |
LOC113516003-54G | Recombinant Galleria mellonella LOC113516003 protein, His-tagged | +Inquiry |
RFL28855PF | Recombinant Full Length Pongo Pygmaeus Nadh Dehydrogenase [Ubiquinone] 1 Beta Subcomplex Subunit 11, Mitochondrial(Ndufb11) Protein, His-Tagged | +Inquiry |
ETS1-28335TH | Recombinant Human ETS1 | +Inquiry |
MYLPF-10325M | Recombinant Mouse MYLPF Protein | +Inquiry |
◆ Native Proteins | ||
PROC-272B | Active Native Bovine Activated Protein C | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSN1-236HCL | Recombinant Human DSN1 lysate | +Inquiry |
ADAL-9039HCL | Recombinant Human ADAL 293 Cell Lysate | +Inquiry |
Cerebellum-65H | Human Cerebellum (LT) Membrane Lysate | +Inquiry |
RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
SOHLH1-1572HCL | Recombinant Human SOHLH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CNGC12 Products
Required fields are marked with *
My Review for All CNGC12 Products
Required fields are marked with *
0
Inquiry Basket