Recombinant Full Length Acanthamoeba Polyphaga Mimivirus Uncharacterized Protein R474(Mimi_R474) Protein, His-Tagged
Cat.No. : | RFL12980AF |
Product Overview : | Recombinant Full Length Acanthamoeba polyphaga mimivirus Uncharacterized protein R474(MIMI_R474) Protein (Q5UQE2) (1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | APMV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-413) |
Form : | Lyophilized powder |
AA Sequence : | MNISIESQLINYCLLFFTVVIIPIFYYIYKIVYLYLSHKLRESLINTSARIFKENESFVK QIIFTITDGVGNLRQDIMDHLQYRQTCNSIKYIVDKVFVLIDNISAIYSNTPVENYNYQY CDNITPVQPLGCGAYCPYYQPYDATFNPDCNLNYDTIYNFDFDKDIIKCDNTSECSETNE TNKNTSHKLKFEYPKRCRKSRRNSRVFSRNFLKTKKSRENNSKTSTTEPFACTKDETTGM YTIKSNAYDTKNSTETNSDNNSEIVSETNSETNYSTPTTAKVNIDDVLAAMTTVYDKSDF GLNDKIKENVADSLKKMCDSSGNIKVDFDDQKLFKTVFDSVYQGLMTDPSIVDNSGYSSP TNESLNGSLTETLNESLNGSFDNSINNIKETLNKSLMDFIDCPSGSINFSNKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIMI_R474 |
Synonyms | MIMI_R474; Uncharacterized protein R474 |
UniProt ID | Q5UQE2 |
◆ Recombinant Proteins | ||
Lamc3-3749M | Recombinant Mouse Lamc3 Protein, Myc/DDK-tagged | +Inquiry |
QPRT-30231TH | Recombinant Human QPRT, T7 -tagged | +Inquiry |
RFL3011RF | Recombinant Full Length Rat Synaptogyrin-1(Syngr1) Protein, His-Tagged | +Inquiry |
APOA4-0597H | Recombinant Human APOA4 Protein (Glu21-Ser396), C-His-tagged | +Inquiry |
NI36-RS10255-0946S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS10255 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
NTF3-29249TH | Native Human NTF3 | +Inquiry |
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD23A-2559HCL | Recombinant Human RAD23A 293 Cell Lysate | +Inquiry |
PLK1S1-3105HCL | Recombinant Human PLK1S1 293 Cell Lysate | +Inquiry |
APEX2-91HCL | Recombinant Human APEX2 cell lysate | +Inquiry |
SEC14L3-1997HCL | Recombinant Human SEC14L3 293 Cell Lysate | +Inquiry |
ELP3-551HCL | Recombinant Human ELP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIMI_R474 Products
Required fields are marked with *
My Review for All MIMI_R474 Products
Required fields are marked with *
0
Inquiry Basket