Recombinant Escherichia coli RELB Protein (1-79 aa), His-Myc-tagged

• Cat.No.: RELB-2561E
• Product Overview: Recombinant Escherichia coli (strain K12) RELB Protein (1-79 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-79 aa
• Description: Antitoxin component of a type II toxin-antitoxin (TA) system. Counteracts the effect of cognate toxin RelE via direct protein-protein interaction, preventing RelE from entering the ribosome A site and thus inhibiting its endoribonuclease activity. An autorepressor of relBE operon transcription. 2 RelB dimers bind to 2 operator sequences; DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity. Increased transcription rate of relBE and activation of relE is consistent with a lower level of RelB in starved cells due to degradation of RelB by protease Lon.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.1 kDa
• AA Sequence: MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: relB Qin prophage; antitoxin/DNA-binding transcriptional repressor RelB [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: RELB
• Synonyms: relB; ECK1558; RC
• Gene ID: 948308
• Protein Refseq: NP_416082
• UniProt ID: P0C079