Recombinant Full Length Human RELB Protein, C-Flag-tagged
Cat.No. : | RELB-1446HFL |
Product Overview : | Recombinant Full Length Human RELB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity and protein kinase binding activity. Involved in lymphocyte differentiation and negative regulation of interferon-beta production. Located in cytosol and nucleoplasm. Part of chromatin; nucleus; and transcription repressor complex. Colocalizes with centrosome. Implicated in breast cancer and immunodeficiency 53. Biomarker of breast cancer and transitional cell carcinoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62 kDa |
AA Sequence : | MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDG GQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRF RYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRV RLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQ MRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQ ADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFA YDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASLVGSNMFPN HYREAAFGGGLLSPGPEATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | MAPK signaling pathway |
Full Length : | Full L. |
Gene Name | RELB RELB proto-oncogene, NF-kB subunit [ Homo sapiens (human) ] |
Official Symbol | RELB |
Synonyms | IREL; I-REL; IMD53; REL-B |
Gene ID | 5971 |
mRNA Refseq | NM_006509.4 |
Protein Refseq | NP_006500.2 |
MIM | 604758 |
UniProt ID | Q01201 |
◆ Recombinant Proteins | ||
RELB-1446HFL | Recombinant Full Length Human RELB Protein, C-Flag-tagged | +Inquiry |
Relb-1853M | Recombinant Mouse Relb protein, His & T7-tagged | +Inquiry |
Relb-5457M | Recombinant Mouse Relb Protein, Myc/DDK-tagged | +Inquiry |
RELB-5320H | Recombinant Human RELB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RELB-6413C | Recombinant Chicken RELB | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELB-1493HCL | Recombinant Human RELB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RELB Products
Required fields are marked with *
My Review for All RELB Products
Required fields are marked with *
0
Inquiry Basket