Recombinant Dog Cationic trypsin Protein, His-SUMO-tagged
Cat.No. : | TRY1-1152C |
Product Overview : | Recombinant Dog Cationic trypsin Protein (24-246aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 24-246 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 36.9 kDa |
AA Sequence : | IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKI IRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKA PILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVC KYVSWIQQTIAAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Cationic trypsin |
Official Symbol | Cationic trypsin |
Synonyms | Cationic trypsin; trypsin; TRY1; EC= 3.4.21.4; EC 3.4.21.4 |
UniProt ID | P06871 |
◆ Recombinant Proteins | ||
Polh-4989M | Recombinant Mouse Polh Protein, Myc/DDK-tagged | +Inquiry |
GMDS-6998M | Recombinant Mouse GMDS Protein | +Inquiry |
RFL655PF | Recombinant Full Length Pseudomonas Putida Potassium-Transporting Atpase C Chain(Kdpc) Protein, His-Tagged | +Inquiry |
Adm-3202M | Recombinant Mouse Adm, GST-tagged | +Inquiry |
ZFP422-6687R | Recombinant Rat ZFP422 Protein | +Inquiry |
◆ Native Proteins | ||
IgG-346D | Native Dog Gamma Globulin Fraction | +Inquiry |
MMP9-38H | Native Human MMP-9 | +Inquiry |
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
LDLR-85H | Native Human Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDH1-4409HCL | Recombinant Human MDH1 293 Cell Lysate | +Inquiry |
KCTD7-895HCL | Recombinant Human KCTD7 cell lysate | +Inquiry |
Cartilage-605R | Rat Cartilage Lysate, Total Protein | +Inquiry |
ZNF396-79HCL | Recombinant Human ZNF396 293 Cell Lysate | +Inquiry |
HCFC2-5612HCL | Recombinant Human HCFC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cationic trypsin Products
Required fields are marked with *
My Review for All Cationic trypsin Products
Required fields are marked with *
0
Inquiry Basket