Recombinant Dog Anionic Trypsin Protein, His-SUMO-tagged
Cat.No. : | TRY2-1121D |
Product Overview : | Recombinant Dog Anionic Trypsin Protein (24-247aa) was expressed in E. coli with His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 24-247 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 40.0 kDa |
AA Sequence : | IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Anionic trypsin |
Official Symbol | Anionic trypsin |
Synonyms | Anionic trypsin; EC 3.4.21.4; TRY2; TRY2_CANLF |
UniProt ID | P06872 |
◆ Recombinant Proteins | ||
RFL7198FF | Recombinant Full Length Francisella Philomiragia Subsp. Philomiragia Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
CD160-3036M | Recombinant Mouse CD160 Protein | +Inquiry |
ADGRF5-5175H | Recombinant Human ADGRF5 Protein | +Inquiry |
MGC174155-5957Z | Recombinant Zebrafish MGC174155 | +Inquiry |
GIMAP3-3554M | Recombinant Mouse GIMAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-29698TH | Native Human MMP9 | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
MYH-10B | Active Native Bovine Myosin Protein | +Inquiry |
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ovary-801G | Guinea Pig Ovary Membrane Lysate, Total Protein | +Inquiry |
FKBP8-6202HCL | Recombinant Human FKBP8 293 Cell Lysate | +Inquiry |
C19orf44-92HCL | Recombinant Human C19orf44 lysate | +Inquiry |
ZNF70-23HCL | Recombinant Human ZNF70 293 Cell Lysate | +Inquiry |
PIWIL2-1360HCL | Recombinant Human PIWIL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Anionic trypsin Products
Required fields are marked with *
My Review for All Anionic trypsin Products
Required fields are marked with *
0
Inquiry Basket