Recombinant Dog Anionic Trypsin Protein, His-SUMO-tagged

Cat.No. : TRY2-1121D
Product Overview : Recombinant Dog Anionic Trypsin Protein (24-247aa) was expressed in E. coli with His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Tag : His&SUMO
ProteinLength : 24-247 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 40.0 kDa
AA Sequence : IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Anionic trypsin
Official Symbol Anionic trypsin
Synonyms Anionic trypsin; EC 3.4.21.4; TRY2; TRY2_CANLF
UniProt ID P06872

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Anionic trypsin Products

Required fields are marked with *

My Review for All Anionic trypsin Products

Required fields are marked with *

0

Inquiry Basket

cartIcon