Recombinant Mouse Ttr protein(21-147aa), His-tagged

• Cat.No.: Ttr-3938M
• Product Overview: Recombinant Mouse Ttr protein(P07309)(21-147aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Mouse
• Tag: His
• Protein length: 21-147aa
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 17.06-26.23 ng/mL.
• Molecular Mass: 16.4 kDa
• AASequence: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Ttr transthyretin [ Mus musculus ]
• Official Symbol: Ttr
• Synonyms: TTR; transthyretin; D17860; AA408768; AI787086; prealbumin; MGC107649
• Gene ID: 22139
• mRNA Refseq: NM_013697
• Protein Refseq: NP_038725