Recombinant Cynomolgus TTR Protein, His-tagged

• Cat.No.: TTR-01H
• Product Overview: Recombinant Cynomolgus TTR Protein with C-terminal His6 fusion tag was expressed in HEK293.

Specification

• Species: Macaca Fascicularis
• Source: HEK293
• Tag: His
• Protein Length: 133
• Description: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
• Form: Buffered aqueous solution
• Molecular Mass: 14.6 kDa
• AA Sequence: GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKEHHHHHH
• Endotoxin: ＜1EU/ug by LAL
• Purity: ＞90% by SDS-PAGE
• Applications: Antigen for antibody production
  ELISA
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.32 mg/ml
• Storage Buffer: Solution in PBS, pH 7.4

Gene Information

• Gene Name: TTR
• Official Symbol: TTR
• Synonyms: Transthyretin,Prealbumin
• Gene ID: 101864775
• mRNA Refseq: NM_001261679.1
• Protein Refseq: NP_001248608.1
• MIM: 176300
• UniProt ID: Q8HXW1