Recombinant Mouse Apoc3 Protein, His-SUMO-tagged

Cat.No. : Apoc3-1126M
Product Overview : Recombinant Mouse Apoc3 Protein (21-99aa) was expressed in E. coli with N-terminal His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 21-99 a.a.
Description : This gene encodes an apolipoprotein which is the major protein component of very-low-density lipoproteins (VLDL) and a minor component of high-density lipoproteins (HDL). The encoded protein is thought to regulate the metabolism of triglyceride-rich lipoproteins and play a role in lipid storage and the mobilization of fat cells. This gene is clustered with three other apolipoprotein genes on chromosome 9 and is associated with coronary disease. Mice lacking this gene have lower levels of total cholesterol in the plasma. Mutations in the human genes causes hyperalphalipoproteinemia 2, a disorder of lipid metabolism which results in a favorable lipid profile (lower LDL-cholesterol, higher HDL-cholesterol and lower levels of serum triglycerides when fasting and after a meal). Alternative splicing results in multiple transcript variants.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 24.9 kDa
AA Sequence : EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPE
DQPTPAIES
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Apoc3 apolipoprotein C-III [ Mus musculus (house mouse) ]
Official Symbol Apoc3
Synonyms apo-CIII; apoC-III; apolipoprotein C3; apolipoprotein C-III
Gene ID 11814
mRNA Refseq NM_023114.3
Protein Refseq NP_075603.1
UniProt ID P33622

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Apoc3 Products

Required fields are marked with *

My Review for All Apoc3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon