Recombinant Mouse Apoc3 Protein, His-SUMO-tagged

• Cat.No.: Apoc3-1126M
• Product Overview: Recombinant Mouse Apoc3 Protein (21-99aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Description: This gene encodes an apolipoprotein which is the major protein component of very-low-density lipoproteins (VLDL) and a minor component of high-density lipoproteins (HDL). The encoded protein is thought to regulate the metabolism of triglyceride-rich lipoproteins and play a role in lipid storage and the mobilization of fat cells. This gene is clustered with three other apolipoprotein genes on chromosome 9 and is associated with coronary disease. Mice lacking this gene have lower levels of total cholesterol in the plasma. Mutations in the human genes causes hyperalphalipoproteinemia 2, a disorder of lipid metabolism which results in a favorable lipid profile (lower LDL-cholesterol, higher HDL-cholesterol and lower levels of serum triglycerides when fasting and after a meal). Alternative splicing results in multiple transcript variants.
• Source: E. coli
• Species: Mouse
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 24.9 kDa
• AA Sequence: EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPE
  DQPTPAIES
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 21-99 a.a.

Gene Information

• Gene Name: Apoc3 apolipoprotein C-III [ Mus musculus (house mouse) ]
• Official Symbol: Apoc3
• Synonyms: apo-CIII; apoC-III; apolipoprotein C3; apolipoprotein C-III
• Gene ID: 11814
• mRNA Refseq: NM_023114.3
• Protein Refseq: NP_075603.1
• UniProt ID: P33622