Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B Protein, His-tagged

• Cat.No.: MPAC1-1272C
• Product Overview: Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B Protein (2-160aa) was expressed in E. coli with N-terminal His-tag.

Specification

• Species: Carpinus betulus
• Source: E.coli
• Tag: His
• ProteinLength: 2-160 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 21.3 kDa
• AA Sequence: GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKER
  VDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMA
  EKLLRAVESYLLAHTAEYN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Major pollen allergen Car b 1 isoforms 1A and 1B
• Official Symbol: Major pollen allergen Car b 1 isoforms 1A and 1B
• Synonyms: Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; Car b 1; Allergen
• UniProt ID: P38949