Recombinant C. rhodostoma Snaclec rhodocytin subunit alpha Protein, His-SUMO-tagged

• Cat.No.: SLYA-1371C
• Product Overview: Recombinant S. cerevisiae Snaclec rhodocytin subunit alpha Protein, His-SUMO-tagged (1-136aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: C.rhodostoma
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-136 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 31.8 kDa
• AA Sequence: GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYV
  WIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Snaclec rhodocytin subunit alpha
• Official Symbol: Snaclec rhodocytin subunit alpha
• Synonyms: Snaclec rhodocytin subunit alpha; Aggretin alpha chain; Rhodoaggretin subunit alpha
• UniProt ID: Q9I841