Recombinant Full Length Zygosaccharomyces Rouxii Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL19541ZF |
Product Overview : | Recombinant Full Length Zygosaccharomyces rouxii Autophagy-related protein 32(ATG32) Protein (C5DZR8) (1-503aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zygosaccharomyces rouxii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-503) |
Form : | Lyophilized powder |
AA Sequence : | MTSTEGTGGGDGKGISGFSDIERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNC AGTTGTGNGSISQSWQTIHRNDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA VHQQLHATPPQKHTKSLEDYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTI TKSLNSSSNSFIMPKLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEF KQYTGILVVFQELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLL YPPVVVNNQPDLLGMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSA ERNGRPHKKRHNNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESV SKDLFVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPA NCLEWPTSDEHTNRVLALGYVML |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; ZYRO0G06666g; Autophagy-related protein 32 |
UniProt ID | C5DZR8 |
◆ Recombinant Proteins | ||
Osbp2-1884R | Recombinant Rat Osbp2 Protein, His-tagged | +Inquiry |
COTL1-4004C | Recombinant Chicken COTL1 | +Inquiry |
ZRANB1-158H | Active Recombinant Human ZRANB1, His-tagged | +Inquiry |
CDK4-11049H | Recombinant Human CDK4, GST-tagged | +Inquiry |
RFL29983MF | Recombinant Full Length Macaca Mulatta Beta-3 Adrenergic Receptor(Adrb3) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
calc1-8308S | Native Salmon calc1 | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
PKLR-244R | Active Native Rabbit Pyruvate Kinase | +Inquiry |
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTN4-2120HCL | Recombinant Human RTN4 293 Cell Lysate | +Inquiry |
CLPTM1-7433HCL | Recombinant Human CLPTM1 293 Cell Lysate | +Inquiry |
GPR148-5796HCL | Recombinant Human GPR148 293 Cell Lysate | +Inquiry |
HDAC8-691HCL | Recombinant Human HDAC8 cell lysate | +Inquiry |
WWP2-001HCL | Recombinant Human WWP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket