Recombinant Bovine IGF1 protein, hFc-tagged
Cat.No. : | IGF1-4644B |
Product Overview : | Recombinant Bovine IGF1 protein(P07455)(50-119aa), fused with N-terminal hFc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | Fc |
Protein Length : | 50-119aa |
Tag : | N-hFc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
◆ Recombinant Proteins | ||
IGF1-558H | Recombinant Human IGF1 Protein, Fc-tagged | +Inquiry |
IGF1-808C | Recombinant Cattle IGF1 protein, His & GST-tagged | +Inquiry |
IGF1-60H | Active Recombinant Human IGF1 protein(Gly49-Ala118) | +Inquiry |
IGF1-109I | Active Recombinant Human IGF1 Protein (70 aa) | +Inquiry |
IGF1-650H | Active Recombinant Human Insulin Like Growth Factor-I, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *
0
Inquiry Basket