Recombinant Human IGF1 Protein, Fc-tagged

• Cat.No.: IGF1-558H
• Product Overview: Recombinant human IGF1 protein with Fc tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 195
• Description: The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.
• Form: Lyophilized
• Molecular Mass: 35 kDa
• AA Sequence: MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst).
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens (human) ]
• Official Symbol: IGF1
• Synonyms: IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I
• Gene ID: 3479
• mRNA Refseq: NM_000618
• Protein Refseq: NP_000609
• MIM: 147440
• UniProt ID: P05019