Recombinant Bovine ASIP Protein (23-133 aa), His-SUMO-tagged
Cat.No. : | ASIP-1930B |
Product Overview : | Recombinant Bovine ASIP Protein (23-133 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-133 aa |
Description : | Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.4 kDa |
AA Sequence : | HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ASIP agouti signaling protein [ Bos taurus (cattle) ] |
Official Symbol | ASIP |
Synonyms | ASIP; Agouti switch protein; |
Gene ID | 404192 |
mRNA Refseq | NM_206843 |
Protein Refseq | NP_996674 |
UniProt ID | Q29414 |
◆ Recombinant Proteins | ||
ASIP-481R | Recombinant Rat ASIP Protein, His (Fc)-Avi-tagged | +Inquiry |
ASIP-4038H | Recombinant Human ASIP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ASIP-1930B | Recombinant Bovine ASIP Protein (23-133 aa), His-SUMO-tagged | +Inquiry |
ASIP-018H | Recombinant Human ASIP protein, His-GST-tagged | +Inquiry |
ASIP-907H | Recombinant Human ASIP protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASIP-8651HCL | Recombinant Human ASIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASIP Products
Required fields are marked with *
My Review for All ASIP Products
Required fields are marked with *
0
Inquiry Basket