Recombinant Human ASIP protein, GST-tagged

• Cat.No.: ASIP-907H
• Product Overview: Human ASIP partial ORF ( NP_001663.2, 33 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: DRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASIP agouti signaling protein [ Homo sapiens (human) ]
• Official Symbol: ASIP
• Synonyms: ASIP; agouti signaling protein; ASP; AGSW; AGTI; AGTIL; SHEP9; agouti-signaling protein; agouti signaling protein, nonagouti homolog; agouti switch protein; nonagouti homolog
• Gene ID: 434
• mRNA Refseq: NM_001672
• Protein Refseq: NP_001663
• MIM: 600201
• UniProt ID: P42127