Recombinant Bovine APOA1 Protein (25-265 aa), His-tagged

• Cat.No.: APOA1-1331B
• Product Overview: Recombinant Bovine APOA1 Protein (25-265 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Bovine
• Source: Yeast
• Tag: His
• Protein Length: 25-265 aa
• Description: Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 29.5 kDa
• AA Sequence: DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: APOA1 apolipoprotein A1 [ Bos taurus (cattle) ]
• Official Symbol: APOA1
• Synonyms: APOA1; Apolipoprotein A1
• Gene ID: 281631
• mRNA Refseq: NM_174242
• Protein Refseq: NP_776667
• UniProt ID: P15497