Recombinant Active Mouse IL17A Protein, His-tagged(C-ter)

• Cat.No.: Il17a-149M
• Product Overview: Recombinant Active Mouse IL17A Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 10^6 IU/mg.
• AA Sequence: MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: 20 mM Sodium citrate (pH 4.5) and 0.2 M NaCl.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Il17a interleukin 17A [ Mus musculus ]
• Official Symbol: Il17a
• Synonyms: IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Il17; Ctla8; IL-17; Ctla-8; IL-17A
• Gene ID: 16171
• mRNA Refseq: NM_010552
• Protein Refseq: NP_034682