Active Recombinant Mouse Il17a Protein

• Cat.No.: Il17a-093M
• Product Overview: Purified recombinant protein of Mouse interleukin 17A (Il17a) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.
• Bio-activity: Measured by its ability to induce IL-6 production by NIH 3T3 cells.
• Molecular Mass: 30 kDa
• AA Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il17a interleukin 17A [ Mus musculus (house mouse) ]
• Official Symbol: Il17a
• Synonyms: Il17a; interleukin 17A; Il17; Ctla8; IL-17; Ctla-8; IL-17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8
• Gene ID: 16171
• mRNA Refseq: NM_010552
• Protein Refseq: NP_034682
• UniProt ID: Q62386