Recombinant Human IL17A, StrepII-tagged

• Cat.No.: IL17A-288H
• Product Overview: Purified, full-length human recombinant IL17A protein (amino acids 24-155, 132 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 30.2 kDa. (Accession NP_002181.1; UniProt Q16552)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 24-155, 132 a.a.
• Description: IL17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLG CINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: ~50% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml

Gene Information

• Gene Name: IL17A interleukin 17A [ Homo sapiens ]
• Official Symbol: IL17A
• Synonyms: IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A
• Gene ID: 3605
• mRNA Refseq: NM_002190
• Protein Refseq: NP_002181
• MIM: 603149
• UniProt ID: Q16552
• Chromosome Location: 6p12
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL23-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Rheumatoid arthritis, organism-specific biosystem; Rheumatoid arthritis, conserved biosystem
• Function: cytokine activity