Recombinant Active Mouse IGF1 Protein, His-tagged(C-ter)

• Cat.No.: Igf1-128M
• Product Overview: Recombinant Active Mouse IGF1 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]
• Form: Powder
• Bio-activity: Determined by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is < 2 ng/mL. The specific activity of recombinant mouse IGF-I is > 5 x 10^5 IU/mg.
• AA Sequence: MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Igf1 insulin-like growth factor 1 [ Mus musculus ]
• Official Symbol: Igf1
• Synonyms: IGF1; insulin-like growth factor 1; insulin-like growth factor I; somatomedin; Igf-1; Igf-I; C730016P09Rik
• Gene ID: 16000
• mRNA Refseq: NM_001111274
• Protein Refseq: NP_001104744