Active Recombinant Mouse Igf1 Protein (71 aa)

• Cat.No.: Igf1-375I
• Product Overview: Recombinant mouse Insulin-like Growth Factor I (rmIGF-I) produced in E. coli is a single non-glycosylated polypeptide chain containing 71 amino acids. A fully biologically active molecule, rmIGF-I has a molecular mass of 7.8kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 71
• Description: Insulin-like Growth Factor I (IGF-I) is a single chain 7 kDa growth-promoting polypeptide originally identified as somatomedin-c. It belongs to the IGF family of peptides, which also includes IGF-II and insulin. The gene expression of IGF-I is mainly regulated by Growth Hormone, and IGF-I executes its functions via signaling through transmembrane tyrosine receptors (IGF Receptors). Most circulating IFG-I is associated with the IGF Binding Protein 3 (IGFBP-3), and the IGFBPs may inhibit the actions of IGFs by competing against the IGF Receptors. IGF-I is active in post-natal and adult animals, and is crucial for somatic growth, as IGF-I null mice show marked retardation in utero. IGF-I is involved in carcinogenesis, and related to prostate cancer as well.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 ng/mL, measured by a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of >1 × 10^5 units/mg.
• Molecular Mass: 7.8 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant mouse Insulin-like Growth Factor I (rmIGF-I) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIGF-I remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Igf1 insulin-like growth factor 1 [ Mus musculus ]
• Official Symbol: Igf1
• Synonyms: IGF1; insulin-like growth factor 1; insulin-like growth factor I; somatomedin; Igf-1; Igf-I; C730016P09Rik
• Gene ID: 16000
• mRNA Refseq: NM_001111274
• Protein Refseq: NP_001104744
• UniProt ID: P05017