Recombinant Active Human IL21 Protein, His-tagged(C-ter)
Cat.No. : | IL21-174H |
Product Overview : | Recombinant Active Human IL21 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Form : | Powder |
Bio-activity : | Determined by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is < 10 ng/mL. |
AA Sequence : | MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL21 interleukin 21 [ Homo sapiens ] |
Official Symbol | IL21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21; |
Gene ID | 59067 |
mRNA Refseq | NM_001207006 |
Protein Refseq | NP_001193935 |
MIM | 605384 |
UniProt ID | Q9HBE4 |
◆ Recombinant Proteins | ||
IL21-238B | Recombinant Bovine Interleukin 21 | +Inquiry |
IL21-117H | Recombinant Human IL21 Protein | +Inquiry |
IL21-24C | Recombinant Cynomolgus Monkey IL21 Protein | +Inquiry |
Il21-581R | Recombinant Rat Il21 protein | +Inquiry |
Il21-169M | Recombinant Mouse Il21 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
0
Inquiry Basket