Recombinant Mouse Il21 protein

• Cat.No.: Il21-169M
• Product Overview: Recombinant Mouse Il21 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 129
• Description: This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human N1186 T cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 × 10⁴ IU/mg.
• Molecular Mass: Approximately 15.0 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids.
• AA Sequence: HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
• Endotoxin: Less than 0.1 EU/μg of rMuIL-21 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il21
• Official Symbol: Il21
• Synonyms: IL21; interleukin 21; interleukin-21; IL-21
• Gene ID: 60505
• mRNA Refseq: NM_021782
• Protein Refseq: NP_068554
• UniProt ID: Q9ES17