Specification
Gene Information
Related Products
Download

Description :	This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of the both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial inflections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Sep 2015]
Source :	E. coli
Species :	Human
Tag :	His
Form :	Powder
Bio-activity :	Determined by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is < 1.1 ng/mL.
AA Sequence :	MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
Endotoxin :	Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
Purity :	> 95% (by SDS-PAGE)
Applications :	SDS-PAGE
Notes :	For laboratory research only, not for drug, diagnostic or other use.
Storage :	Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer :	PBS (pH 8.0)
Reconstitution :	It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Name	IFNG interferon, gamma [ Homo sapiens ]
Official Symbol	IFNG
Synonyms	IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI;
Gene ID	3458
mRNA Refseq	NM_000619
Protein Refseq	NP_000610
MIM	147570
UniProt ID	P01579