Recombinant Active Human GDF6 Protein, His-tagged(C-ter)

Cat.No. : GDF6-106H
Product Overview : Recombinant Active Human GDF6 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily of secreted signaling molecules. It is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene result in colobomata, which are congenital abnormalities in ocular development, and in Klippel-Feil syndrome (KFS), which is a congenital disorder of spinal segmentation. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 63-240 ng/mL.
AA Sequence : MTAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name GDF6 growth differentiation factor 6 [ Homo sapiens ]
Official Symbol GDF6
Synonyms GDF6; growth differentiation factor 6; growth/differentiation factor 6; BMP13; GDF-6; Klippel-Feil syndrome; Klip-Feil malformation; Klippel-Feil malformation; growth/differentiation factor 16; KFM; KFS; KFS1; KFSL; SGM1; CDMP2; MCOP4; SCDO4; MCOPCB6; MGC158100; MGC158101;
Gene ID 392255
mRNA Refseq NM_001001557
Protein Refseq NP_001001557
MIM 601147
UniProt ID Q6KF10

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GDF6 Products

Required fields are marked with *

My Review for All GDF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon