Recombinant Human GDF6 protein

• Cat.No.: GDF6-381H
• Product Overview: Recombinant Human GDF6 protein was expressed in Escherichia coli.

Specification

• Description: Growth/differentiation factors (GDF-1 to GDF-15) are members of the BMP family of TGF-beta superfamily proteins. They are produced as inactive preproproteins which are then cleaved and assembled into active secreted homodimers. GDF dimers are disulfide-linked with the exception of GDF-3 and -9. GDF proteins are important during embryonic development, particularly in the skeletal, nervous, and muscular systems.
• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 2.0 μg/ml, corresponding to a specific activity of > 500 IU/mg.
• Molecular Mass: Approximately 27.1 kDa, a disulfide-linked homodimeric protein containing two 120 amino acids.
• Protein length: 120
• AA Sequence: TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
• Endotoxin: Less than 0.1 EU/µg of rHuGDF-6/BMP-13 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: GDF6
• Official Symbol: GDF6
• Synonyms: GDF6; growth differentiation factor 6; growth/differentiation factor 6; BMP13; GDF-6; Klippel-Feil syndrome; Klip-Feil malformation; Klippel-Feil malformation; growth/differentiation factor 16; KFM; KFS; KFS1; KFSL; SGM1; CDMP2; MCOP4; SCDO4; MCOPCB6; MGC158100; MGC158101
• Gene ID: 392255
• mRNA Refseq: NM_001001557
• Protein Refseq: NP_001001557
• MIM: 601147
• UniProt ID: Q6KF10