Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein
Cat.No. : | BDGL_002355-152A |
Product Overview : | Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acinetobacter calcoaceticus |
Source : | E.coli |
Description : | putative outer membrane protein |
Form : | 50mMTris-HCl, pH 8.0, 200mMNaCl, 4M Urea. |
Molecular Mass : | ~75 kDa |
AA Sequence : | AENENVEKLETIRIKAHPLEQTSKDFAVADTVVDQKHLTEGAATIGDALNSEVGIYANQFGAGSSRPVIRGQDGPRVKVLQNSSENVDVSTLSPDHAVTVDPVLAKQVEVIRGPSTLLFGAGTVGGLVNVIDNKIPTQMPENGYEGQVGLRYNTGSDEKLASAGVTVGLGSQVALRVEGLTRDANNYIAPNYIHEGEKERRVDNTFAQGDSVNVGLSWIYDRGYTGISYSNRRDQYGLPGHSHEYESCSAHLGGRPHLHCDAHEHDHEEGEEAHAHEEHEHEHGGPWIDLKSERYDFKTELNDPFAGFQKLRAQASYTDYQHDEIEEGAIATRFQNKGYDGRIELVHNPIADWEGVIGTQLGQQKLNLTGEEAFMAPTTTKKWSVFALEHKQWKDVHFELSARADQQEINVDDNSKQDFDGSAFSYAGAANWEFAPNYKLSFVASHQERLPLAQELYANGAHFATNTYELGNDQLSKEKSNNVELGLHFDNDKLDYHLHVYHNWFDDYIYAQTLDRYKDFRLVQYTQDKARFYGAEGEIGYQITPMYKISAFGDYVRGKIDAEGNAPRIPAGRLGTKVDADFGDGFSGSAEYYHVFNQDKIAAYETETEGYNMLNLGVAYSGQYGAKTDYRVYLKANNLLDDTVYQHASFLSNIPQVGRNFTVGVDFSF |
Purity : | >92% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Gene Name | BDGL_002355 putative outer membrane protein [ Acinetobacter pittii PHEA-2 ] |
Official Symbol | BDGL_002355 |
Gene ID | 11636886 |
Protein Refseq | YP_004996623 |
UniProt ID | F0KNW6 |
◆ Recombinant Proteins | ||
RFL33316CF | Recombinant Full Length Carboxydothermus Hydrogenoformans Nadh-Quinone Oxidoreductase Subunit A(Nuoa) Protein, His-Tagged | +Inquiry |
TUBA8-6360R | Recombinant Rat TUBA8 Protein | +Inquiry |
IgG1Fc-07H | Active Recombinant Human IgG1Fc protein | +Inquiry |
SLC12A7-1727H | Recombinant Human SLC12A7 protein, His & T7-tagged | +Inquiry |
RFL27950RF | Recombinant Full Length Rat Protein Triqk(Triqk) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LINC00851-4335HCL | Recombinant Human MGC44328 293 Cell Lysate | +Inquiry |
GMFG-5882HCL | Recombinant Human GMFG 293 Cell Lysate | +Inquiry |
SLC31A1-1736HCL | Recombinant Human SLC31A1 293 Cell Lysate | +Inquiry |
BBS4-8502HCL | Recombinant Human BBS4 293 Cell Lysate | +Inquiry |
CST8-7226HCL | Recombinant Human CST8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDGL_002355 Products
Required fields are marked with *
My Review for All BDGL_002355 Products
Required fields are marked with *
0
Inquiry Basket