Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein
Cat.No. : | BDGL_002355-151A |
Product Overview : | Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acinetobacter calcoaceticus |
Source : | E.coli |
Description : | putative outer membrane protein |
Form : | 50mM Tris-HCl, pH 8.0, 200mM NaCl. |
Molecular Mass : | ~33 kDa |
AA Sequence : | AENENVEKLETIRIKAHPLEQTSKDFAVADTVVDQKHLTEGAATIGDALNSEVGIYANQFGAGSSRPVIRGQDGPRVKVLQNSSENVDVSTLSPDHAVTVDPVLAKQVEVIRGPSTLLFGAGTVGGLVNVIDNKIPTQMPENGYEGQVGLRYNTGSDEKLASAGVTVGLGSQVALRVEGLTRDANNYIAPNYIHEGEKERRVDNTFAQGDSVNVGLSWIYDRGYTGISYSNRRDQYGLPGHSHEYESCSAHLGGRPHLHCDAHEHDHEEGEEAHAHEEHEHEH |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Gene Name | BDGL_002355 putative outer membrane protein [ Acinetobacter pittii PHEA-2 ] |
Official Symbol | BDGL_002355 |
Gene ID | 11636886 |
Protein Refseq | YP_004996623 |
UniProt ID | F0KNW6 |
◆ Recombinant Proteins | ||
BMP8A-161H | Active Recombinant Human BMP8A Protein (Ala264-His402), C-His tagged, Animal-free, Carrier-free | +Inquiry |
GP1BA-1401H | Recombinant Human GP1BA Protein (17-531 aa), His-tagged | +Inquiry |
ADAMTS9-8214Z | Recombinant Zebrafish ADAMTS9 | +Inquiry |
BMPR1A-2876H | Recombinant Human BMPR1A protein, His-tagged | +Inquiry |
RFL7509BF | Recombinant Full Length Bovine Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ALB-5362B | Native Bovine Albumin | +Inquiry |
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
Alb-7992M | Native Mouse Serum Albumin | +Inquiry |
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPAT-2983HCL | Recombinant Human PPAT 293 Cell Lysate | +Inquiry |
ARID3B-120HCL | Recombinant Human ARID3B cell lysate | +Inquiry |
PCSK9-2775RCL | Recombinant Rhesus PCSK9 cell lysate | +Inquiry |
SRSF1-1910HCL | Recombinant Human SFRS1 293 Cell Lysate | +Inquiry |
NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDGL_002355 Products
Required fields are marked with *
My Review for All BDGL_002355 Products
Required fields are marked with *
0
Inquiry Basket