Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein
Cat.No. : | BDGL_002355-153A |
Product Overview : | Recombinant Acinetobacter calcoaceticus BDGL_002355 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acinetobacter calcoaceticus |
Source : | E.coli |
Description : | putative outer membrane protein |
Form : | 50mM Tris-HCl, pH 8.0, 200mM NaCl, 4M Urea. |
Molecular Mass : | ~46 kDa |
AA Sequence : | GGPWIDLKSERYDFKTELNDPFAGFQKLRAQASYTDYQHDEIEEGAIATRFQNKGYDGRIELVHNPIADWEGVIGTQLGQQKLNLTGEEAFMAPTTTKKWSVFALEHKQWKDVHFELSARADQQEINVDDNSKQDFDGSAFSYAGAANWEFAPNYKLSFVASHQERLPLAQELYANGAHFATNTYELGNDQLSKEKSNNVELGLHFDNDKLDYHLHVYHNWFDDYIYAQTLDRYKDFRLVQYTQDKARFYGAEGEIGYQITPMYKISAFGDYVRGKIDAEGNAPRIPAGRLGTKVDADFGDGFSGSAEYYHVFNQDKIAAYETETEGYNMLNLGVAYSGQYGAKTDYRVYLKANNLLDDTVYQHASFLSNIPQVGRNFTVGVDFSF |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Gene Name | BDGL_002355 putative outer membrane protein [ Acinetobacter pittii PHEA-2 ] |
Official Symbol | BDGL_002355 |
Gene ID | 11636886 |
Protein Refseq | YP_004996623 |
UniProt ID | F0KNW6 |
◆ Recombinant Proteins | ||
Cd40lg-790R | Recombinant Rat Cd40lg protein, His & GST-tagged | +Inquiry |
MYL3-6760HF | Recombinant Full Length Human MYL3 Protein, GST-tagged | +Inquiry |
RFL36656MF | Recombinant Full Length Mycobacterium Ulcerans Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
PROM1-161H | Recombinant Human PROM1 Protein, C-His-tagged | +Inquiry |
CARHSP1-26089TH | Recombinant Human CARHSP1, HA-tagged | +Inquiry |
◆ Native Proteins | ||
APCS-31189TH | Native Human APCS | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Pzp-3279H | Native Human Pzp | +Inquiry |
C1R-96H | Active Native Human C1r Enzyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRPD-1609HCL | Recombinant Human SIRPD cell lysate | +Inquiry |
USP46-001HCL | Recombinant Human USP46 cell lysate | +Inquiry |
UBXN8-536HCL | Recombinant Human UBXN8 293 Cell Lysate | +Inquiry |
FSD2-286HCL | Recombinant Human FSD2 lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDGL_002355 Products
Required fields are marked with *
My Review for All BDGL_002355 Products
Required fields are marked with *
0
Inquiry Basket