Recombinant 2019-nCoV NSP3 protein, His-tagged
Cat.No. : | NSP3-4436V |
Product Overview : | Recombinant 2019-nCoV NSP3 protein(P0DTD1/YP_009725299.1)(746-1060aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sars-Cov-2 |
Source : | E.coli |
Tag : | His |
Protein Length : | 746-1060aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.7 kDa |
AA Sequence : | EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
NSP3-81V | Recombinant COVID-19 NSP3 protein, His-tagged | +Inquiry |
NSP3-31V | Recombinant COVID-19 NSP3 protein, His-tagged | +Inquiry |
NSP3-362V | Recombinant COVID-19 NSP3 protein, His-tagged | +Inquiry |
NSP3-4436V | Recombinant 2019-nCoV NSP3 protein, His-tagged | +Inquiry |
nsP3-434V | Recombinant Ross River Virus nsP3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSP3 Products
Required fields are marked with *
My Review for All NSP3 Products
Required fields are marked with *
0
Inquiry Basket