GMP Recombinant Porcine THPO Protein, His-Tagged
Cat.No. : | THPO-01P |
Product Overview : | GMP Recombinant Porcine THPO Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | Thrombopoietin is a glycoprotein hormone produced mainly by the liver and the kidney that regulates the production of platelets by the bone marrow. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that fragment into large numbers of platelets. |
Form : | Lyophilized |
AA Sequence : | APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >95% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | THPO thrombopoietin [ Sus scrofa (pig) ] |
Official Symbol | THPO |
Synonyms | ML; MGDF |
Gene ID | 100620258 |
mRNA Refseq | XM_005670050.3 |
Protein Refseq | XP_005670107.1 |
◆ Recombinant Proteins | ||
THPO-2755H | Recombinant Human THPO protein(22-353 aa), N-SUMO & N-His-tagged | +Inquiry |
THPO-99H | Recombinant Human THPO protein, His-tagged | +Inquiry |
Thpo-6417M | Active Recombinant Mouse Thpo Protein | +Inquiry |
THPO-27H | Active Recombinant Human Thrombopoietin | +Inquiry |
Thpo-177M | Recombinant Mouse Thrombopoietin | +Inquiry |
◆ Cell & Tissue Lysates | ||
THPO-2273CCL | Recombinant Cynomolgus THPO cell lysate | +Inquiry |
THPO-2831MCL | Recombinant Mouse THPO cell lysate | +Inquiry |
THPO-2832HCL | Recombinant Human THPO cell lysate | +Inquiry |
THPO-001HCL | Recombinant Human THPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THPO Products
Required fields are marked with *
My Review for All THPO Products
Required fields are marked with *
0
Inquiry Basket