Recombinant Human THPO protein(22-353 aa), N-SUMO & N-His-tagged

• Cat.No.: THPO-2755H
• Product Overview: Recombinant Human THPO protein(P40225)(22-353 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: N-SUMO & N-His
• ProteinLength: 22-353 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: THPO thrombopoietin [ Homo sapiens (human) ]
• Official Symbol: THPO
• Synonyms: THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs
• Gene ID: 7066
• mRNA Refseq: NM_000460
• Protein Refseq: NP_000451
• MIM: 600044
• UniProt ID: P40225