Active Recombinant Rat Il10 Protein (161 aa)

• Cat.No.: Il10-371I
• Product Overview: Recombinant rat Interleukin-10 (IL-10)produced in E. coli is a single non-glycosylated polypeptide chain containing 161 amino acids. A fully biologically active molecule, recombinant rat Interleukin-10 (IL-10) has a molecular mass of 18.7kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 161
• Description: Interleukin-10 (IL-10), also known as cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine produced by a variety of cell lines including T-cells, macrophages and mast cells. IL-10 is classified as a class-2 cytokine, a set of cytokines including IL-19, IL-20, IL-22, IL-24, and IL-26. IL-10 can inhibit the synthesis of pro-inflammatory cytokines such as IFN-gamma, IL-2, IL-3, TNF and GM-CSF. It also stimulates Th2 responses, but suppresses the antigen-presentation capacity of antigen presenting cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 μg/mL, measured by a cell proliferation assay using C6 cells, corresponding to a specific activity of > 2.0 × 10^3 units/mg.
• Molecular Mass: 18.7 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MSKGHSIKGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNIVLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant rat Interleukin-10 (IL-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, IL-10 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Il10 interleukin 10 [ Rattus norvegicus ]
• Official Symbol: Il10
• Synonyms: IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X
• Gene ID: 25325
• mRNA Refseq: NM_012854
• Protein Refseq: NP_036986
• UniProt ID: P29456