Active Recombinant Rat Il10 Protein (161 aa)
Cat.No. : | Il10-371I |
Product Overview : | Recombinant rat Interleukin-10 (IL-10)produced in E. coli is a single non-glycosylated polypeptide chain containing 161 amino acids. A fully biologically active molecule, recombinant rat Interleukin-10 (IL-10) has a molecular mass of 18.7kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 161 |
Description : | Interleukin-10 (IL-10), also known as cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine produced by a variety of cell lines including T-cells, macrophages and mast cells. IL-10 is classified as a class-2 cytokine, a set of cytokines including IL-19, IL-20, IL-22, IL-24, and IL-26. IL-10 can inhibit the synthesis of pro-inflammatory cytokines such as IFN-gamma, IL-2, IL-3, TNF and GM-CSF. It also stimulates Th2 responses, but suppresses the antigen-presentation capacity of antigen presenting cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 μg/mL, measured by a cell proliferation assay using C6 cells, corresponding to a specific activity of > 2.0 × 10^3 units/mg. |
Molecular Mass : | 18.7 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MSKGHSIKGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNIVLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant rat Interleukin-10 (IL-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, IL-10 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Il10 interleukin 10 [ Rattus norvegicus ] |
Official Symbol | Il10 |
Synonyms | IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X; |
Gene ID | 25325 |
mRNA Refseq | NM_012854 |
Protein Refseq | NP_036986 |
UniProt ID | P29456 |
◆ Recombinant Proteins | ||
Il10-484R | Recombinant Rat Il10 protein, His-tagged | +Inquiry |
IL10-28293TH | Recombinant Human IL10 | +Inquiry |
Il10-45M | Active Recombinant Mouse Il10 Protein (Ser19-Ser178), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL10-33O | Recombinant Ovine IL10 Protein | +Inquiry |
IL10-001R | Active Recombinant Rat IL10, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
0
Inquiry Basket