Active Recombinant Rat Ifng Protein (134 aa)
Cat.No. : | Ifng-378I |
Product Overview : | Recombinant Rat Interferon gamma (IFN-γ) produced in E. coli is a single non-glycosylated polypeptide chain containing 134 amino acids. A fully biologically active molecule, rrIFN-γ has a molecular mass of 15.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 134 |
Description : | Interferon gamma (IFN-γ), also known as Type II interferon,is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and activates the IFN-γ/JAK/STAT pathway. IFN-γ signaling promotesbiological functions primarily related to antiviral and antibacterial defense, apoptosis, inflammation, and regulation of innate and acquired immune responses. While IFN-γ–induced inflammatory cascades summon a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 ng/mL, measured by cytotoxicity assay using WEHI-279 cells, corresponding to a specific activity of >2 × 10^6 units/mg. |
Molecular Mass : | 15.5 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | GTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Rat IFN-γ remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Rat IFN-γ should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Ifng interferon gamma [ Rattus norvegicus ] |
Official Symbol | Ifng |
Synonyms | IFNG; interferon gamma; IFN-gamma; IFNG2; |
Gene ID | 25712 |
mRNA Refseq | NM_138880 |
Protein Refseq | NP_620235 |
UniProt ID | P01581 |
◆ Recombinant Proteins | ||
IFNG-497H | Recombinant Human IFNG Protein | +Inquiry |
IFNG-7822C | Recombinant Canine IFNG protein | +Inquiry |
IFNG-1165R | Active Recombinant Rhesus Protein | +Inquiry |
IFNG-8157B | Recombinant Bovine IFNG protein, His-tagged | +Inquiry |
Ifng-114M | Recombinant Mouse Ifng protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ifng Products
Required fields are marked with *
My Review for All Ifng Products
Required fields are marked with *
0
Inquiry Basket