Active Recombinant Rat Ifng Protein (134 aa)

• Cat.No.: Ifng-378I
• Product Overview: Recombinant Rat Interferon gamma (IFN-γ) produced in E. coli is a single non-glycosylated polypeptide chain containing 134 amino acids. A fully biologically active molecule, rrIFN-γ has a molecular mass of 15.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Description: Interferon gamma (IFN-γ), also known as Type II interferon,is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and activates the IFN-γ/JAK/STAT pathway. IFN-γ signaling promotesbiological functions primarily related to antiviral and antibacterial defense, apoptosis, inflammation, and regulation of innate and acquired immune responses. While IFN-γ–induced inflammatory cascades summon a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.
• Source: E. coli
• Species: Rat
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 ng/mL, measured by cytotoxicity assay using WEHI-279 cells, corresponding to a specific activity of >2 × 10^6 units/mg.
• Molecular Mass: 15.5 kDa, observed by reducing SDS-PAGE.
• Protein length: 134
• AA Sequence: GTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Rat IFN-γ remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Rat IFN-γ should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Ifng interferon gamma [ Rattus norvegicus ]
• Official Symbol: Ifng
• Synonyms: IFNG; interferon gamma; IFN-gamma; IFNG2
• Gene ID: 25712
• mRNA Refseq: NM_138880
• Protein Refseq: NP_620235
• UniProt ID: P01581