Recombinant Human IFNG Protein

Cat.No. : IFNG-78H
Product Overview : IFNG was produced in E. coli cells transformed with human IFNG gene. This product is sterile and does not contain any components of animal origin.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.
AA Sequence : QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Purity : > 95% by SDS-PAGE
Quality Control Test : Verified by Mass Spectrometry analysis.
Storage : Avoid repeated freeze-thaw cycles. 12 months at -20 to -80 centigrade. 1 month at 2 to 8 centigrade.
Concentration : 0.5 mg/mL
Storage Buffer : Sterile filtered through a 0.2 micron filter in 50% glycerol, 10 mM Phosphate buffer at pH 7.4, 200
Gene Name IFNG interferon, gamma [ Homo sapiens (human) ]
Official Symbol IFNG
Synonyms IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI
Gene ID 3458
mRNA Refseq NM_000619
Protein Refseq NP_000610
MIM 147570
UniProt ID P01579

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFNG Products

Required fields are marked with *

My Review for All IFNG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon