Recombinant Human IFNG Protein

• Cat.No.: IFNG-78H
• Product Overview: IFNG was produced in E. coli cells transformed with human IFNG gene. This product is sterile and does not contain any components of animal origin.

Specification

• Description: This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.
• Source: E. coli
• Species: Human
• Tag: Non
• AA Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
• Purity: > 95% by SDS-PAGE
• Quality Control Test: Verified by Mass Spectrometry analysis.
• Storage: Avoid repeated freeze-thaw cycles. 12 months at -20 to -80 centigrade. 1 month at 2 to 8 centigrade.
• Concentration: 0.5 mg/mL
• Storage Buffer: Sterile filtered through a 0.2 micron filter in 50% glycerol, 10 mM Phosphate buffer at pH 7.4, 200

Gene Information

• Gene Name: IFNG interferon, gamma [ Homo sapiens (human) ]
• Official Symbol: IFNG
• Synonyms: IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI
• Gene ID: 3458
• mRNA Refseq: NM_000619
• Protein Refseq: NP_000610
• MIM: 147570
• UniProt ID: P01579