Active Recombinant Mouse Cxcl3 Protein (73 aa)
Cat.No. : | Cxcl3-294C |
Product Overview : | Recombinant mouse DCIP-1/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmDCIP-1/CXCL3 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Protein Length : | 73 |
Description : | Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP2b. CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of cerebellum, during morphogenesis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of mouse DCIP-1/CXCL3 on Ca^2+ mobilization assay in CHO-K1/Ga15/mCXCR2 cells (human Ga15 and mouse CXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/mL. |
Molecular Mass : | 8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Mouse DCIP-1/CXCL3 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse DCIP-1/CXCL3 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Cxcl3 chemokine (C-X-C motif) ligand 3 [ Mus musculus ] |
Official Symbol | Cxcl3 |
Synonyms | CXCL3; chemokine (C-X-C motif) ligand 3; C-X-C motif chemokine 3; dendritic cell inflammatory protein 1; Dcip1; Gm1960; |
Gene ID | 330122 |
mRNA Refseq | NM_203320 |
Protein Refseq | NP_976065 |
UniProt ID | Q3UNK9 |
◆ Recombinant Proteins | ||
CXCL3-16H | Recombinant Human CXCL3 protein | +Inquiry |
CXCL3-236H | Active Recombinant Mouse Chemokine (C-X-C motif) Ligand 3, HIgG1 Fc-tagged | +Inquiry |
CXCL3-18H | Active Recombinant Human CXCL3 | +Inquiry |
CXCL3-4106M | Recombinant Mouse CXCL3 Protein | +Inquiry |
Cxcl3-7390M | Recombinant Mouse Cxcl3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL3-207HCL | Recombinant Human CXCL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl3 Products
Required fields are marked with *
My Review for All Cxcl3 Products
Required fields are marked with *
0
Inquiry Basket