Active Recombinant Mouse Il5 Protein, His-Tagged
Cat.No. : | Il5-01M |
Product Overview : | Recombinant mouse Il5 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 5 (IL-5) is an interleukin produced by type-2 T helper cells and mast cells. Through binding to the interleukin-5 receptor, interleukin 5 stimulates B cell growth and increases immunoglobulin secretion - primarily IgA. It is also a key mediator in eosinophil activation. |
Form : | Lyophilized powder |
AA Sequence : | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQF LDYLQEFLGVMSTEWAMEG with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-5 is > 5 x 10^6 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il5 interleukin 5 [ Mus musculus (house mouse) ] |
Official Symbol | Il5 |
Synonyms | Il-5 |
Gene ID | 16191 |
mRNA Refseq | NM_010558.1 |
Protein Refseq | NP_034688.1 |
UniProt ID | P04401 |
◆ Recombinant Proteins | ||
IL5-5813P | Recombinant Pig IL5 protein, His-tagged | +Inquiry |
IL5-125H | Recombinant Human IL5 | +Inquiry |
IL5-269H | Recombinant Human IL5, StrepII-tagged | +Inquiry |
IL5-412M | Active Recombinant Mouse Interleukin-5 | +Inquiry |
IL5-4331F | Recombinant Feline IL5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il5 Products
Required fields are marked with *
My Review for All Il5 Products
Required fields are marked with *
0
Inquiry Basket