Recombinant Human IL5, StrepII-tagged

• Cat.No.: IL5-269H
• Product Overview: Purified, full-length human recombinant IL5 protein (amino acids 20-134, 115 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 15.2 kDa. (Accession NP_000870; UniProt P05113)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 20-134, 115 a.a.
• Description: IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes. The receptor of this cytokine is a heterodimer, whose beta subunit is shared with the receptors for IL3 and colony stimulating factor 2 (CSF2/GM-CSF).
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLI KKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80~90%% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IL5 interleukin 5 (colony-stimulating factor, eosinophil) [ Homo sapiens ]
• Official Symbol: IL5
• Synonyms: IL5; interleukin 5 (colony-stimulating factor, eosinophil); interleukin-5; B cell differentiation factor I; EDF; eosinophil differentiation factor; IL 5; interleukin 5; T cell replacing factor; TRF; T-cell replacing factor; B-cell differentiation factor I; IL-5
• Gene ID: 3567
• mRNA Refseq: NM_000879
• Protein Refseq: NP_000870
• MIM: 147850
• UniProt ID: P05113
• Chromosome Location: 5q23-q31
• Pathway: Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Asthma, organism-specific biosystem; Asthma, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem
• Function: cytokine activity; growth factor activity; interleukin-5 receptor binding; protein binding