Recombinant Active Human IL36RN Protein, His-tagged(C-ter)
Cat.No. : | IL36RN-200H |
Product Overview : | Recombinant Active Human IL36RN Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to inhibit IL-36 gamma-induced IL-8 secretion in PBMC cells. The ED50 for this effect is < 2 ng/mL in the presence of 500 ng/mL of recombinant human IL-36 gamma. |
AA Sequence : | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL36RN interleukin 36 receptor antagonist [ Homo sapiens ] |
Official Symbol | IL36RN |
Synonyms | IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP; |
Gene ID | 26525 |
mRNA Refseq | NM_012275 |
Protein Refseq | NP_036407 |
MIM | 605507 |
UniProt ID | Q9UBH0 |
◆ Recombinant Proteins | ||
Il1f5-307M | Recombinant Mouse Il1f5, None tagged | +Inquiry |
IL36RN-5185H | Recombinant Human IL36RN Protein, GST-tagged | +Inquiry |
Il1f5-2836M | Recombinant Mouse Il1f5 protein, His & T7-tagged | +Inquiry |
IL36RN-3478H | Recombinant Human IL36RN protein, His-tagged | +Inquiry |
IL36RN-2009H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
IL36RN-5239HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL36RN Products
Required fields are marked with *
My Review for All IL36RN Products
Required fields are marked with *
0
Inquiry Basket