Active Recombinant Mouse Il1b Protein (153 aa)

• Cat.No.: Il1b-030I
• Product Overview: Recombinant Mouse Il1b Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 153
• Description: IL-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50 as determined by the dose-dependent stimulation of murine D10S cells is < 0.002 ng/mL, corresponding to a specific activity of > 5 × 10^8 units/mg.
• Molecular Mass: Approximately 17.5kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
• AA Sequence: MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
• Endotoxin: Less than 1 EU/mg of rmIL-1β as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il1b interleukin 1 beta [ Mus musculus ]
• Official Symbol: Il1b
• Synonyms: IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; Il-1b; IL-1beta
• Gene ID: 16176
• mRNA Refseq: NM_008361
• Protein Refseq: NP_032387
• UniProt ID: P10749