Active Recombinant Human IL1B Protein
Cat.No. : | IL1B-244H |
Product Overview : | Recombinant Human IL1B Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Interleukin-1 beta (IL-1β) is a non-secreted proinflammatory cytokine produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. Both IL-1α and IL-1β binds to the same receptor and has similar but not identical biological properties; The mature human IL1β shares 96 % amino acid sequence identity with rhesus and 67 % -78 % with canine, mouse and rat IL-1β. |
Form : | Sterile Filtered White lyophil |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 1.0 pg ml, corresponding to a specific activity of > 1.0×10^9 IU/mg. |
Molecular Mass : | Approximately 17.3 kDa |
AA Sequence : | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Endotoxin : | Less than 1 EU/μg of rHuIL-1a as determined by LAL method. |
Purity : | > 97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. |
Gene Name | IL1B interleukin 1, beta [ Homo sapiens (human) ] |
Official Symbol | IL1B |
Synonyms | IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA; |
Gene ID | 3553 |
mRNA Refseq | NM_00576 |
Protein Refseq | NP_00567 |
MIM | 147720 |
UniProt ID | P01584 |
◆ Recombinant Proteins | ||
IL1β-82P | Recombinant Porcine Interleukin-1 beta | +Inquiry |
Il1b-383M | Active Recombinant Mouse Il1b protein | +Inquiry |
Il1b-6735M | Recombinant Mouse Il1b Protein (Val118-Ser269) | +Inquiry |
Il1b-533G | Recombinant Golden hamster Il1b protein, His&Strep II-tagged | +Inquiry |
IL1B-1170H | Recombinant Human IL1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
0
Inquiry Basket
There is no product in the inquiry basket.