Active Recombinant Mouse IGF2 Protein
Cat.No. : | IGF2-123M |
Product Overview : | Recombinant Mouse IGF2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Insulin-like growth factor II (IGF-II) is an important fetal growth hormone made by theca cells during gestation. IGF-II engages the IGF-I receptor (IGF1R) to mediate embryonic growth. IGF-II also binds the sink IGF-II receptor (IGF2R) leading to IGF-II degradation. |
Bio-activity : | FDC-P1 cell proliferation, ED50≤50 ng/mL |
Molecular Mass : | Monomer, 7.4 kDa (with 67 amino acids) |
AA Sequence : | AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Igf2 insulin-like growth factor 2 [ Mus musculus (house mouse) ] |
Official Symbol | IGF2 |
Synonyms | IGF2; insulin-like growth factor 2; insulin-like growth factor II; multiplication-stimulating polypeptide; Mpr; M6pr; Peg2; Igf-2; Igf-II; AL033362; |
Gene ID | 16002 |
mRNA Refseq | NM_001122736 |
Protein Refseq | NP_001116208 |
UniProt ID | P09535 |
◆ Recombinant Proteins | ||
IGF2-7544B | Recombinant Bovine IGF2 protein, hFc-tagged | +Inquiry |
IGF2-457H | Recombinant Human Insulin-like Growth Factor 2 (Somatomedin A) | +Inquiry |
IGF2-819R | Recombinant Rabbit IGF2 protein, His & T7-tagged | +Inquiry |
IGF2-3005R | Recombinant Rat IGF2 Protein | +Inquiry |
IGF2-01H | Recombinant Human IGF2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IGF2-29116TH | Native Human IGF2 | +Inquiry |
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2-5267HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF2 Products
Required fields are marked with *
My Review for All IGF2 Products
Required fields are marked with *
0
Inquiry Basket