Active Recombinant Mouse Ifnl2 Protein

• Cat.No.: Ifnl2-145M
• Product Overview: Purified recombinant protein of Mouse interleukin 28A (Il28a) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression
• Bio-activity: Determined by its ability to activate STAT following receptor-ligand interaction.
• Molecular Mass: 19.8 kDa
• AA Sequence: MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ifnl2 interferon lambda 2 [ Mus musculus (house mouse) ]
• Official Symbol: Ifnl2
• Synonyms: Ifnl2; interferon lambda 2; Il28a; IL-28A; EG330496; interferon lambda-2; IFN-lambda-2; IFN-lambda2; interferon-lambda2; interleukin-28A
• Gene ID: 330496
• mRNA Refseq: NM_001024673
• Protein Refseq: NP_001019844
• UniProt ID: Q4VK74