Active Recombinant Human IFNL2 Protein

• Cat.No.: IFNL2-944H
• Product Overview: Recombinant Human IFNL2 was expressed in E. coli.

Specification

• Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28B (IL28B), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
• Source: E. coli
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Bio-activity: Determined by its ability to activate STAT phosphorylation in an ISRE Luciferase Reporter Assay using human colon carcinoma COLO205 cells. The expected ED50 is 0.3-0.5 ng/ml.
• Molecular Mass: 19.6 kDa
• AA Sequence: PVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Tag: Non

Gene Information

• Gene Name: IFNL2 interferon lambda 2 [ Homo sapiens (human) ]
• Official Symbol: IFNL2
• Synonyms: IL28A; IL-28A
• Gene ID: 282616
• mRNA Refseq: NM_172138
• Protein Refseq: NP_742150
• MIM: 607401
• UniProt ID: Q8IZJ0